Protein Info for SMc02635 in Sinorhizobium meliloti 1021

Annotation: DNA repair protein RecO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF11967: RecO_N" amino acids 13 to 85 (73 residues), 60.3 bits, see alignment E=1.5e-20 TIGR00613: DNA repair protein RecO" amino acids 16 to 233 (218 residues), 138.3 bits, see alignment E=1.5e-44 PF02565: RecO_C" amino acids 102 to 233 (132 residues), 99.5 bits, see alignment E=1.6e-32

Best Hits

Swiss-Prot: 100% identical to RECO_RHIME: DNA repair protein RecO (recO) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03584, DNA repair protein RecO (recombination protein O) (inferred from 100% identity to smk:Sinme_0882)

Predicted SEED Role

"DNA recombination and repair protein RecO" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92KH5 at UniProt or InterPro

Protein Sequence (259 amino acids)

>SMc02635 DNA repair protein RecO (Sinorhizobium meliloti 1021)
MLRFPRRVYASFMQWSDEAIILGIRRHGESSVIAEVMTPGHGRHLGLVRSGRSRTMQPVL
QPGNSVEVSWRARLDEHLGEFRVEPLQLRAASLIETATSVYGIQALGALLRLLPERDPHP
HLYEALAVIVDHLQDPADAGELFVRFELAVLNDLGFGLDLSRCGATGARSELVYVSPKSG
RAICREAGAPYADRMLALPDFLSGGSRAADHESLAAAFRLTAYFLNRHVYEPRGVDAASA
RDGFVHATLKALKSASSAA