Protein Info for SMc02609 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 107 to 127 (21 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 45 to 180 (136 residues), 34.9 bits, see alignment E=2e-12 PF12833: HTH_18" amino acids 242 to 321 (80 residues), 89.3 bits, see alignment E=2.5e-29 PF00165: HTH_AraC" amino acids 281 to 319 (39 residues), 30.3 bits, see alignment 5.3e-11

Best Hits

Swiss-Prot: 100% identical to GLXA_RHIME: HTH-type transcriptional regulator GlxA (glxA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3417)

Predicted SEED Role

"HTH-type transcriptional regulator glxA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See O87389 at UniProt or InterPro

Protein Sequence (324 amino acids)

>SMc02609 transcriptional regulator (Sinorhizobium meliloti 1021)
MAASSDSRNVQRIGFLLVRNFALMSYASATEPLRAANLLAGRPLYQIVPLAPGGGTVASS
SGLSVGCADLESEGESCHTVFVCAGGEPTDWADTSASHTTLRRLSRLGIRIGGISSGAFV
LAAAGLLDNRDFTIHWEHAPALKEAFPHLNPRHARFVLDGGIATCGGGVAPLDMMHAMIA
ERLGTDFARRVSDWYLHAAVAEPAAPQRGSAAERFGTNHPALLAVLEKMETAIERPLDRT
AMARLAGVSPRHLDRLFREHRGTGFLDTYREIRLRHARRLLQQSPLSIPEIAYATGFSSP
AHFSNAFKRLFSQTPGSLRRRSGS