Protein Info for SMc02607 in Sinorhizobium meliloti 1021

Annotation: sarcosine oxidase subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01374: sarcosine oxidase, delta subunit family
  • amino acids 4 to 84 (81 residues), 122.8 bits, E=2.7e-40
• PF04267: SoxD
  • amino acids 5 to 80 (76 residues), 102.2 bits, E=6.8e-34

Best Hits

Swiss-Prot: 100% identical to SOXD_RHIME: Sarcosine oxidase subunit delta (soxD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00304, sarcosine oxidase, subunit delta [EC: 1.5.3.1] (inferred from 100% identity to sme:SMc02607)

Predicted SEED Role

"Sarcosine oxidase delta subunit (EC 1.5.3.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.5.3.1)

MetaCyc Pathways

• glycine betaine degradation I (7/8 steps found)
• creatinine degradation I (2/4 steps found)
• creatinine degradation II (1/5 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1

Sequence Analysis Tools

See O87387 at UniProt or InterPro

Protein Sequence (92 amino acids)

>SMc02607 sarcosine oxidase subunit delta (Sinorhizobium meliloti 1021)
MASLVPCPNCGRRPKEEFTIKGAALSRPEADADSIDWFDYVYLRENPRGAYEEYWHHTSG
CRRWLVVARDTVTHEIAACCDAAGRARSEARK