Protein Info for SMc02599 in Sinorhizobium meliloti 1021

Annotation: L-aspartate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 PF01266: DAO" amino acids 16 to 133 (118 residues), 34.6 bits, see alignment E=2.5e-12 PF00890: FAD_binding_2" amino acids 16 to 388 (373 residues), 284 bits, see alignment E=3.7e-88 TIGR00551: L-aspartate oxidase" amino acids 16 to 502 (487 residues), 489.8 bits, see alignment E=4.3e-151 PF02910: Succ_DH_flav_C" amino acids 436 to 517 (82 residues), 43.3 bits, see alignment E=5.1e-15

Best Hits

Swiss-Prot: 100% identical to NADB_RHIME: L-aspartate oxidase (nadB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00278, L-aspartate oxidase [EC: 1.4.3.16] (inferred from 100% identity to smk:Sinme_0889)

Predicted SEED Role

"L-aspartate oxidase (EC 1.4.3.16)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 1.4.3.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92R32 at UniProt or InterPro

Protein Sequence (532 amino acids)

>SMc02599 L-aspartate oxidase (Sinorhizobium meliloti 1021)
MLTDHFRPQSFNGIDDIVIVGGGLAGLFCALKLAPRPVTILAAAPIGYGASSAWAQGGIA
AAMSKGDTFEKHVADTVAAGAGIVDEKMTRMMVAEGPARIHDLLEFGVPFDRDLEGKLLL
SREAAHSERRIVRVKGDMAGKSIMEALIAAVRNTPSIRVIEGYVVEELVREGRFISGVIA
RPDAGQSKSRVSFPARAVVLCSGGVGHLYAVTTNPWEACGQGVGMAARAGAIIADPEFVQ
FHPTAIDIGKDPAPLATEALRGDGATLINSEGRRFMLDIHPDGELAPRDIVSRGVFAEVQ
AGRGAFLDCTKAVGRHFPEMFPTVYASCMAAGIDPVRQPIPVTPAVHYHMGGVLTDGEGR
TSIDGLWAAGEVTSTGVHGANRLASNSLLEAVVFAARIAENIKGSLPAPKLTAWGDNAGE
NDDPVTVEDSPPFKVLRQLMSDCVGVVRTRESLTRAIRGIAELERTNKRLRFANIATTAK
LIAIAALQRTESRGGHFRADCPDERPEWRRRTYLTLAQAERLAAEVAESEPA