Protein Info for SMc02598 in Sinorhizobium meliloti 1021

Annotation: nicotinate-nucleotide pyrophosphorylase carboxylating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)
  • amino acids 17 to 296 (280 residues), 312.5 bits, E=1.1e-97
• PF02749: QRPTase_N
  • amino acids 27 to 115 (89 residues), 93.7 bits, E=5.9e-31
• PF01729: QRPTase_C
  • amino acids 117 to 296 (180 residues), 193.8 bits, E=2e-61

Best Hits

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 99% identity to smk:Sinme_0890)

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD de novo biosynthesis II (from tryptophan) (4/9 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of NAD biosynthesis in eukaryotes (6/14 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

See Q92R31 at UniProt or InterPro

Protein Sequence (299 amino acids)

>SMc02598 nicotinate-nucleotide pyrophosphorylase carboxylating protein (Sinorhizobium meliloti 1021)
MTALRPELPALMVEEQVKAALLEDLGRAGDITTLSTIGPDRTAAANMSVREAGVVAGLEL
ARTAFRLIDPSIRFEALAADGDRVAPGTTVARISGRARGLLSAERVALNFLMHLSGIATY
TATFADEIAHTGAKVCCTRKTIPGLRALEKYAVRLGGGSNHRYGLDDAVLIKDNHIAVSG
GVAGAVRAARAYCGHLVKVEVEVDGLAQLREALTASPDVVLLDNMGPELLSEAVAINAAH
WGLSVASYPGDLRRTRLEASGNVQIETIRAIAETGVDYISTSKITMAAPTLDIGLDVSI