Protein Info for SMc02589 in Sinorhizobium meliloti 1021

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13416: SBP_bac_8" amino acids 62 to 339 (278 residues), 72.9 bits, see alignment E=4e-24 PF01547: SBP_bac_1" amino acids 87 to 338 (252 residues), 36.7 bits, see alignment E=5.1e-13

Best Hits

KEGG orthology group: K05777, putative thiamine transport system substrate-binding protein (inferred from 100% identity to smk:Sinme_3401)

Predicted SEED Role

"ABC transporter, periplasmic substrate-binding protein YnjB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92T97 at UniProt or InterPro

Protein Sequence (408 amino acids)

>SMc02589 ABC transporter substrate-binding protein (Sinorhizobium meliloti 1021)
MIRRAGKIIAAALLALGLAGRASATDAGNWEAVAAEASGQTVYFNAWGGSENVNAYIRWA
GDEMKARYGVTVVHVKLDDTAKATATVLAEKSAGKDEGGSVDLVWINGENFAAMKRQGLL
YAPGWATKLPNWRYVDHENMPTVLTDFTIPTDGLESPWGGAKLVFFYDSARMKASELPDS
AADLLEWAAANPGRFSYPQPPDFTGSSFLKQVLIELVDDRAKLQKPVDETTFATDAAPLF
AYLDRLTPLLWRKGKAYPQNYADMKQKLADGELDIIFAFNPAEASSAIANGELPETVRSF
AFSGGTLGNTHFVAIPYNATAKAGALLLADFLLTPEAQLRKQDPKIWGDPTVLSPAKLPA
ADRSAFERLDLGIATLRPGELGPALDEPHPDWMIRIETEWIRRYGAAN