Protein Info for SMc02579 in Sinorhizobium meliloti 1021

Annotation: cytochrome P450 monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 415 to 426 (12 residues), see Phobius details PF00067: p450" amino acids 50 to 449 (400 residues), 226.8 bits, see alignment E=2.6e-71

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3391)

Predicted SEED Role

"small molecule metabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TA5 at UniProt or InterPro

Protein Sequence (466 amino acids)

>SMc02579 cytochrome P450 monooxygenase (Sinorhizobium meliloti 1021)
MDTRPEPFEPPAPVPRTGIPSRLEIIRTVLRNPLELWGEPSYTLPWIETKFINQRTLIVN
DPGLIRYILVENAANYEMSNVRRLILRPILRDGLLTAEGEVWKRSRKAMAPVFTPRHAQG
FAGQMLRVCEAFVDRYAGASSEPFVTNVAVDMTELTFEILAETLFSGEIAVEKQGFAANV
EELLHRMGRVDPMDLLVAPSWVPRLTRIGGRKVLDRFRGVVSETMSLRRRRTTEAPGDVP
NDFLTLLLQLEGPDGLSTSEIEDNILTFIGAGHETTARALAWCFYCVANTPAYRETMEQE
IDSVLASGADPVDWLGRMPHVLAAFEEALRLYPPAPSINRAAIEEDAWTSPEGERVPIRK
GISVLVMPWTLHRHALYWQKPRAFMPERFLPENRDKINRFQYLPFGAGPRVCIGATFALQ
EAVIALAVLMHRFRFDLTDETHPWPVQRLTTQPRGGLPMKVSARVK