Protein Info for SMc02577 in Sinorhizobium meliloti 1021

Annotation: ATP-dependent protease ATP-binding subunit HslU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 5 to 435 (431 residues), 618.1 bits, see alignment E=4.9e-190 PF07728: AAA_5" amino acids 52 to 89 (38 residues), 23.8 bits, see alignment 1.2e-08 PF00004: AAA" amino acids 53 to 102 (50 residues), 26.6 bits, see alignment 2.2e-09 amino acids 221 to 324 (104 residues), 25.9 bits, see alignment E=3.6e-09 PF07724: AAA_2" amino acids 193 to 321 (129 residues), 91.8 bits, see alignment E=1.6e-29 PF10431: ClpB_D2-small" amino acids 327 to 397 (71 residues), 25 bits, see alignment E=4.9e-09

Best Hits

Swiss-Prot: 100% identical to HSLU_RHIME: ATP-dependent protease ATPase subunit HslU (hslU) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 100% identity to smk:Sinme_3389)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TA7 at UniProt or InterPro

Protein Sequence (435 amino acids)

>SMc02577 ATP-dependent protease ATP-binding subunit HslU (Sinorhizobium meliloti 1021)
MSNFSPREIVSELDRYIIGQKDAKRAVAIALRNRWRRQQLDDELRDEVMPKNILMIGPTG
VGKTEISRRLAKLAGAPFVKVEATKFTEVGYVGRDVEQIVRDLVEVGISLVREKRRAEVK
AKAHQNAEERVLDALVGTTASPATRDSFRKKLRANELDDKEIEVDVAEAGSPGGAFEIPG
MPGANIGVLNLSEMFGKALGGRTKKVKTTVKDSYALLVNDESDKLLDNEQIQREAVAAAE
NDGIVFLDEIDKIATREGGIGAGVSREGVQRDLLPLVEGTTVATKYGPVKTDHILFIASG
AFHVAKPSDLLPELQGRLPIRVELRALTKEDFRRILTETEASLIRQYKALLETEGVALDF
TEDAIDALAEVAVQLNANVENIGARRLQTVMERVLDDVSFNAPDRGGQGVTIDAEYVRRH
VGDLAANTDLSRYIL