Protein Info for SMc02517 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 10 to 32 (23 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 208 to 225 (18 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 277 (197 residues), 69.9 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to sme:SMc02517)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LM2 at UniProt or InterPro

Protein Sequence (288 amino acids)

>SMc02517 ABC transporter permease (Sinorhizobium meliloti 1021)
MEKTWNNKAWFMVLPVLVLVAFSAVIPLMTVVNYSVQDTFGNNEFFWAGTDWFLDVLESD
RFWDALTRNLIFSAIILAIEIPLGIVIALNMPKRGIGVPICLVLMALPLLIPWNVVGTIW
QVFGRVDIGLLGRTLASLGINYNYVQNPLDAWVTLIVMDVWHWTSLVVLLCYAGLVSIPD
AYYQAAKIDGASRWSVFRYIQLPKMKRVLLIAFLLRFMDSFMIYTEPFVVTGGGPGNSTT
FLSIDLVKTAIGQFDLGPAAALSIIYFLIILLLSWIFYTVMTTSDAQG