Protein Info for SMc02513 in Sinorhizobium meliloti 1021

Annotation: permease transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 25 to 50 (26 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 174 to 191 (18 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 238 to 261 (24 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details amino acids 352 to 370 (19 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details amino acids 413 to 433 (21 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 24 to 432 (409 residues), 344.6 bits, see alignment E=8.5e-107 PF00860: Xan_ur_permease" amino acids 25 to 401 (377 residues), 306.2 bits, see alignment E=1.5e-95 TIGR03173: xanthine permease" amino acids 27 to 434 (408 residues), 503 bits, see alignment E=5.7e-155

Best Hits

Swiss-Prot: 40% identical to UACT_ECOLI: Uric acid transporter UacT (uacT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to sme:SMc02513)

MetaCyc: 40% identical to urate:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN0-530

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LL9 at UniProt or InterPro

Protein Sequence (490 amino acids)

>SMc02513 permease transmembrane protein (Sinorhizobium meliloti 1021)
MANSAEETVSPTRPEDEKLGIGANLAYGLQHVLTMYGGIVAVPLILGQAAGLGSGDIGLL
ITASLFAGGLATILQTMGLPFFGSQLPLVQGVSFSGVATMIAISGNGGLQSVLGAVIAAS
LIGLLITPIFSRITRFFPPLVTGIVITTIGLTLMPVAARWAMGGNSSAPDFGSPANIQLA
AVTLVIVLLLSKLGSAAISRLSILLALIIGTVIAYFAGMADFSQVTEGPFFALPLVFHFG
YPTFEVAAIASMFIVIMVTLVETSADILAVGEIIETKVDSRRLGDGLRADMLSSLLAPIF
GSFTQSAFAQNVGLVAVTGVKSRYVVATGGLFLVTLGLLPVMGRIVAAVPSSVLGGAGIV
LFGTVAASGIRTLSKVDYANNMNLVIVATSIGFGMIPIASPTFYEHFPAWVETIFHSGIS
SAALMAISLNLIFNHMTAGNSDQQSVFVAGTERTLRYQDIARLHDGDYFLNGKLYDANGT
EVPVLAAEAH