Protein Info for SMc02512 in Sinorhizobium meliloti 1021

Annotation: permease transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details amino acids 392 to 413 (22 residues), see Phobius details amino acids 425 to 445 (21 residues), see Phobius details amino acids 452 to 474 (23 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 14 to 472 (459 residues), 378.8 bits, see alignment E=3.5e-117 PF00860: Xan_ur_permease" amino acids 19 to 172 (154 residues), 114.2 bits, see alignment E=3.1e-37 amino acids 208 to 442 (235 residues), 234.4 bits, see alignment E=9.4e-74

Best Hits

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 100% identity to smk:Sinme_3076)

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LL8 at UniProt or InterPro

Protein Sequence (494 amino acids)

>SMc02512 permease transmembrane protein (Sinorhizobium meliloti 1021)
MNDASSIHPVDERLPIGRLATLGIQHVLVMYGGAVAVPLIVGRALQLSPEDVAFLISADL
FVCGIVTIIQSLGLTRGIGIRLPVMMGVTFAAVGPMVSMAAMTPGIDGARTIFGAIIGAG
LVALLIAPIMGRLLKFFPPVVTGTIILVIGVTLMRVGVNWIFGNPFGPTAPKLVDPAHAQ
WLAGLKQLAATGGPAVPDGLVLGATVPNPIYAEPGHVALAAFVLVSILVVARFGKGLISN
IAVLIGIVIGCVAAALLGMMHFDRVASAGWFAVVTPLRFGMPIFDPVLIATMSLVMIVVM
IESTGMFLALGEMTNREVKQQQLTAGLRVDGLGTIIGGLFNTFPYTSFSQNVGLVGVTGV
KSRYVCVMGGVIMILLGVIPKMGALVEAVPTFVLGGAGLVMFGMVAATGVRILSTVDFKS
SRNNLFVVAVSVGFGLIPMIAPNFLMWMPHAIHPIIESGIVLAAVSAVVLNAFFNGLSIE
RSACVEAARLADGH