Protein Info for SMc02506 in Sinorhizobium meliloti 1021

Annotation: iron transport system membrane ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 60 to 85 (26 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details PF00950: ABC-3" amino acids 14 to 268 (255 residues), 260.7 bits, see alignment E=7.7e-82

Best Hits

Swiss-Prot: 53% identical to Y359_HAEIN: Probable iron transport system membrane protein HI_0359 (HI_0359) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K11606, manganese/iron transport system permease protein (inferred from 100% identity to sme:SMc02506)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitD" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LL2 at UniProt or InterPro

Protein Sequence (284 amino acids)

>SMc02506 iron transport system membrane ABC transporter protein (Sinorhizobium meliloti 1021)
MMPSLDMLLAVFEFEFMRNALLISVLVAIPTAMLSCFLVLKGWSLMGDAISHAVFPGVVV
SYIVGLPLAVGAFTAGMCCALLTGYLKENSRIKQDTVMGVVFSGMFGLGLVLYTKIQSDV
HLDHILFGDMLGIGWGDILETGLIALFAAGILGLKWRDLLLHAFDPAQARAIGLRVGWLH
YGLLAILSLTIVGALKAVGLILAIAMLIAPGAIAYLVTRTFGAMLAVAVMVAVAASFCGV
YLSFFIDSAPAPTIVLLMTAMFLLAFAYSTWKIARAEAQRTSVE