Protein Info for SMc02504 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF13412: HTH_24" amino acids 12 to 56 (45 residues), 54.1 bits, see alignment E=3.1e-18 PF13404: HTH_AsnC-type" amino acids 12 to 51 (40 residues), 55.5 bits, see alignment E=1.4e-18 PF13384: HTH_23" amino acids 14 to 55 (42 residues), 26.6 bits, see alignment E=1.4e-09 PF08279: HTH_11" amino acids 16 to 55 (40 residues), 28.5 bits, see alignment E=4e-10 PF01037: AsnC_trans_reg" amino acids 74 to 149 (76 residues), 50.6 bits, see alignment E=5.1e-17

Best Hits

Swiss-Prot: 30% identical to LYSM_SACS2: HTH-type transcriptional regulator LysM (lysM) from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

KEGG orthology group: None (inferred from 100% identity to sme:SMc02504)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LL1 at UniProt or InterPro

Protein Sequence (150 amino acids)

>SMc02504 transcriptional regulator (Sinorhizobium meliloti 1021)
MPIQVDDMHVTDKDRELLAILSENARMPTATIARRLGLSRTTVQARIERLEREGVIAGYG
VRLSENYEKGLVRAHVLITIAPRALSRVTPELAAIREIRMLHSVSGSFDLIAVVAAASIS
ELDLLIDRIGEIEGVEKTLSSIILSTRIDR