Protein Info for SMc02498 in Sinorhizobium meliloti 1021

Annotation: F0F1 ATP synthase subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00213: OSCP
  • amino acids 13 to 184 (172 residues), 172.3 bits, E=5.2e-55
• TIGR01145: ATP synthase F1, delta subunit
  • amino acids 13 to 183 (171 residues), 117.9 bits, E=2.8e-38

Best Hits

Swiss-Prot: 100% identical to ATPD_RHIME: ATP synthase subunit delta (atpH) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02113, F-type H+-transporting ATPase subunit delta [EC: 3.6.3.14] (inferred from 100% identity to smk:Sinme_3090)

Predicted SEED Role

"ATP synthase delta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

See Q92LK5 at UniProt or InterPro

Protein Sequence (188 amino acids)

>SMc02498 F0F1 ATP synthase subunit delta (Sinorhizobium meliloti 1021)
MPVADTSQLISGVAERYASSLFELALDAGSIEAVGADLTRIQALIDGSDDLKRLIVSPVF
SADDQFKAISALVEKFGFSGLVGNFLKVVARNRRLFVLPGIIKAFRLLAARHKGEITADV
TSAHALTLAQEIELKAALKGVTGKDVAVNVTVDPSILGGLIVKVGSRQIDTSLRTKLSTL
KLALKEVG