Protein Info for SMc02495 in Sinorhizobium meliloti 1021
Annotation: translaldolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to TAL_RHIME: Probable transaldolase (tal) from Rhizobium meliloti (strain 1021)
KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 100% identity to sme:SMc02495)MetaCyc: 31% identical to fructose-6-phosphate aldolase 1 (Escherichia coli K-12 substr. MG1655)
4.1.2.-
Predicted SEED Role
"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)
MetaCyc Pathways
- Bifidobacterium shunt (14/15 steps found)
- Rubisco shunt (10/10 steps found)
- superpathway of glucose and xylose degradation (15/17 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
- pentose phosphate pathway (8/8 steps found)
- pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
- formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Pentose phosphate pathway
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.2.1.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92LK3 at UniProt or InterPro
Protein Sequence (217 amino acids)
>SMc02495 translaldolase (Sinorhizobium meliloti 1021) MKFFVDTADVKDIRELNDLGLLDGVTTNPSLILKAGRDIVEVTKEICSIVEGPVSAEVTA TEYSAMMKEAAALSKIADNICIKLPLTLDGLKACKALTSDGHQTNVTLCFSANQALLAAK AGATFVSPFIGRLDDIAVDGMDLIREIRQIFDNYGYETEILAASVRTVNHVKEAALIGAD VVTAPPATLKALVKHPLTDKGLEMFLADWAKTGQKIA