Protein Info for SMc02473 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 94 to 271 (178 residues), 53.2 bits, see alignment E=1.7e-18

Best Hits

Swiss-Prot: 34% identical to YOR2_CALSR: Putative ABC transporter permease protein ORF2 from Caldicellulosiruptor sp. (strain Rt8B.4)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to smk:Sinme_3115)

Predicted SEED Role

"ABC-type sugar transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92LJ0 at UniProt or InterPro

Protein Sequence (282 amino acids)

>SMc02473 ABC transporter permease (Sinorhizobium meliloti 1021)
MTDTTSSVRMTAATRLYLYVSLSLVAMLVLLPLVTTALGGFKSLGDLRVNPFGLPSEWLW
SNYLDILFGDRYWRQMLNSLFIAAITVVLTVIVSAMAAFTFAHVRFFGSNHLLNYFLIGL
MFPAATAILPLFIRIRDLGLLDTYWGVILPQVAFGLGMSILLFRNYFRNLPEELFQAAFV
DGCGYIRFFWYISLPLSRPIVSTVGIITFVHSWNSYILPLIMLNTEAKYPWPLGIMVYRG
EFGTDWQLVLAFITLTILPTVIVFFLAQKHIIAGLTAGAVKS