Protein Info for SMc02452 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 177 to 200 (24 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 305 to 322 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 60 to 316 (257 residues), 139 bits, see alignment E=8.8e-45

Best Hits

Swiss-Prot: 38% identical to RBSC_HAEIN: Ribose import permease protein RbsC (rbsC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to sme:SMc02452)

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MP9 at UniProt or InterPro

Protein Sequence (325 amino acids)

>SMc02452 ABC transporter permease (Sinorhizobium meliloti 1021)
MSITSASAAAPSSFTPRVLNAIRHYGTFGIFLVLVIVASFWSDAFLTERNLMNVVRQVAS
GAGIMAIGMLFVVLTRGIDLSVGSIAAVGSVLCAHLVAAQGYGVPMAILLVILTGAACGV
VTGFFVAYMRLPSFVISLAMMAIARGISLIISAGRPITMGSPGASLVDFGSGFLFGIPQP
AILMLVIYAIGGVVLLYTSFGRIVTAIGSNEEAVRLSGVPVERYVLSVYVISGALAAVAG
IVAAGRTGIGTPQVGVGAELDVIAAVVIGGASLMGGRGGMFNTLLGALILGIITNIMNLA
GVPGYHQNVYLLAMLIQFVTARSRR