Protein Info for SMc02435 in Sinorhizobium meliloti 1021

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF17827: PrmC_N" amino acids 8 to 77 (70 residues), 62.6 bits, see alignment E=1.3e-20 TIGR00536: methyltransferase, HemK family" amino acids 15 to 282 (268 residues), 192.6 bits, see alignment E=7.8e-61 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 27 to 281 (255 residues), 265 bits, see alignment E=6.6e-83 PF13847: Methyltransf_31" amino acids 117 to 192 (76 residues), 37.8 bits, see alignment E=4.5e-13 PF06325: PrmA" amino acids 117 to 208 (92 residues), 33.5 bits, see alignment E=1e-11 PF05175: MTS" amino acids 118 to 196 (79 residues), 45.3 bits, see alignment E=2.3e-15 PF13649: Methyltransf_25" amino acids 122 to 192 (71 residues), 35.1 bits, see alignment E=5.4e-12 PF08241: Methyltransf_11" amino acids 123 to 192 (70 residues), 22.5 bits, see alignment E=4.5e-08

Best Hits

Swiss-Prot: 58% identical to PRMC_AGRFC: Release factor glutamine methyltransferase (prmC) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to smk:Sinme_2665)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MK6 at UniProt or InterPro

Protein Sequence (293 amino acids)

>SMc02435 methyltransferase (Sinorhizobium meliloti 1021)
MAQTLDSLLAESRDRLKAAGLESAGLDARHLISGLLDLALAALLTRGREPISDEDAARIR
AAVERRAAHEPVYRILGEREFFGLKLKLSKETLEPRPDTEILVDCLIPHARRIASSKGSC
RIVDLGTGTGAICLALLAAVLDARGLGTDISEDALATALENARRNGLAERFGTVRSKWFE
AVDGRFDIIVSNPPYIRSNVIPELEPEVRYHDPVAALDGGEDGLDAYRAIASHAGRHLET
DGVIGLEIGFDQKRAVTALFEAQGFRLLSAAKDLGGNDRVLVFQQDIERSNNR