Protein Info for SMc02423 in Sinorhizobium meliloti 1021

Annotation: oligopeptide transport ATP-binding ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF00005: ABC_tran" amino acids 28 to 187 (160 residues), 101 bits, see alignment E=1.4e-32 PF13304: AAA_21" amino acids 142 to 222 (81 residues), 32.2 bits, see alignment E=1.7e-11 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 237 to 320 (84 residues), 82.5 bits, see alignment E=9.2e-28 PF08352: oligo_HPY" amino acids 238 to 302 (65 residues), 71.1 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 48% identical to OPPD_HAEIN: Oligopeptide transport ATP-binding protein OppD (oppD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to smk:Sinme_2649)

MetaCyc: 46% identical to dipeptide ABC transporter ATP binding subunit DppD (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ML5 at UniProt or InterPro

Protein Sequence (327 amino acids)

>SMc02423 oligopeptide transport ATP-binding ABC transporter protein (Sinorhizobium meliloti 1021)
MGDIQEPVIEVRNLRVDFPSRRGTVTALSDVSLSIRPGEILGVVGESGAGKSMTGLAIQG
LLEAPGHIAGGEVWLGKRRIDTLDDRAMEKIRGREIGAIFQDPLTSLNPLFSVGAQLVET
IRRHLGFGKAEARARAVQLLRDVGIPSPEERVNQYPHQFSGGMRQRVVIALALAASPKLV
IADEPTTALDVSIQAQIISLLRKLCKEKQTAVMLVTHDMGVIAEAADRIAVMYAGRLIEI
GAVEQVLHQPRHPYTQGLMGSIPSLGARVERLNQIDGSMPRLDAIPDGCAFNPRCKMAGP
RCRRERPELIFAGPSASACWLSAGGTA