Protein Info for SMc02415 in Sinorhizobium meliloti 1021

Annotation: peptide-binding periplasmic ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00496: SBP_bac_5" amino acids 71 to 440 (370 residues), 289.2 bits, see alignment E=2.6e-90

Best Hits

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 100% identity to smk:Sinme_2642)

Predicted SEED Role

"Putative gluthatione transporter,solute-binding component" in subsystem Utilization of glutathione as a sulphur source

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MM2 at UniProt or InterPro

Protein Sequence (526 amino acids)

>SMc02415 peptide-binding periplasmic ABC transporter protein (Sinorhizobium meliloti 1021)
MSRLNRFLISALAAAAIAAPALATSASAATLRWGSRADIYSLDPDSVPSTSNLAFLNHIY
EGLIRYGPNFEIEPALATEWKLIDSKHWRFTLRKGVKFHDGADFTADDVVASMNRVSDPT
SPLRGNIPLYVGVKKVDDFTVDIEVSAPSALFLNDMSNIFMFSAKWLKDNNAEKPTDIAS
NTENYATHNTNGTGPFKLESRVPDSKTVLLVNDQWWDQKKHNLDRIEYIPISSAATRVAA
LLSSEIDLLDSAPIQDLPRLESSPGITVSKRTELRTVFIGFNGKEKLEDGRPNPFLDLRV
RQAVEASIDRDLINKKIMRGLARPSGSLIAPEIAGYAKSLDTYQPADSKLAQKLLEDAGQ
KDLAFTYLCMNDESINEEDICSGIANMLKRAGFQPTIDMGPRAVQQPKRTNGKADMFNLS
WANEPTLDAYSLLSQVLSTRSGSTGVSNYGGWSYPELDDLVKKAAQEPDTAKRLALEEQA
LKIAKDKAILIPLHQQPIAWGMLDKVKSVDFRADNKPRHWHTQMAE