Protein Info for SMc02403 in Sinorhizobium meliloti 1021

Annotation: murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 681 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF01464: SLT" amino acids 525 to 626 (102 residues), 78.8 bits, see alignment E=1.3e-26

Best Hits

KEGG orthology group: K08309, soluble lytic murein transglycosylase [EC: 3.2.1.-] (inferred from 100% identity to sme:SMc02403)

Predicted SEED Role

"Soluble lytic murein transglycosylase precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92R56 at UniProt or InterPro

Protein Sequence (681 amino acids)

>SMc02403 murein transglycosylase (Sinorhizobium meliloti 1021)
MMRGTVFLPVAAMIGAGMLAFSADAAEGRIPVPTSKPDARKIGSLETGELSTILGADLKS
GLDALSDRQPEKAIAVRDRMPAGTLDRHILAWAIAVSGQKGIPSYDIAAAQRELQGWPGL
KSLRSHSERALYRENAPAADVIAAFGTTRPETAEGAIILARALAAQGQSSAAATHLRAFW
LSEALDKDTETKILSEFSDLLTTEDHRQRMEMLLYRTRIDQAERFSDLGKAQSLFRAWAA
VTRGSSNAASLIEAVDASWRSKPSYLFIRIEHLRKQQKYAEAARLLDQMPKDDGALVNPG
EWWVEQRIVSRGLLDAGDFRGAYRIAANHAAKRATDLVDAEFHAGWYALRGLEEPETAAL
HFRRILEASSRPISASRAWYWLGRAAEAGGPGDAREYFTNAARYPATFYGQLAAARLGQA
KLDMSYPSPTQEDRIRLEGREAVKAIGRLEAAGHGWRAESLYRALAEELTSPGELAILAE
RAEKSGNHQLSLQIGKIAFGRGIEVAALAFPIGVIPPSADIDGAGKALAYAIARQESAFN
PAAISVANARGLLQLLPGTAKGVASRYGLAYSKDRLTSDAGYNATLGAHYLGEQIDSFGG
SYILTFIAYNAGPRRVPDWLARYGDPRGKPIDEVVDWIERIPFEETRNYVQRVMENYQVY
KSRLGQDTDIVADLRLGRALP