Protein Info for SMc02383 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 58 to 62 (5 residues), see Phobius details amino acids 74 to 75 (2 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 123 (18 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 155 to 185 (31 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 246 to 270 (25 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 315 to 333 (19 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details PF13231: PMT_2" amino acids 55 to 216 (162 residues), 61.4 bits, see alignment E=6.7e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc02383)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92R71 at UniProt or InterPro

Protein Sequence (495 amino acids)

>SMc02383 hypothetical protein (Sinorhizobium meliloti 1021)
MLEAVNRRPGAAVLAVAGYFLLCIILRVSVSSSLEIDEAEQAFLSQFLALGYGPQPPFYN
WLQYGLAELIGPSLATMTILKNGLLFLCCLFYGLAARLVLADRRLPPIAMLGVLTLPPVF
LLAQRDLSHTIAALFAVSLFLYGFLRTLKRPSLFSYLLTGVAVGIGLMAKYNFVLVPVAA
IVAVLPERELRARILDWRILPAIAIATLIVLPHAYWMLQNFGFASGGTLNEMREREAEGL
LLQAFYGVYSLGSAIIGGSLGPLLVFGLVFRGKLRAIWQAESQWSRIIGRMLALCLIAVL
LVVLGVAATHVREKWLVLFLVLIPLYLCLKIEAANIDLTDSLRRFFLLVCVIALGALVMV
SARAVVRPWFGDYSRLNIPYAAFAEAVAQAEGGQPALILANDKQIAGNLRTQFSRAQVTM
PRPSNALPVDMSRRPLLLVWHDDAQPEAPVPDLLRNALSELGVPGAAAAPRHLALPYLYG
TGSDRYGFSYIWVAE