Protein Info for SMc02372 in Sinorhizobium meliloti 1021

Annotation: transport transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 235 (225 residues), 47.7 bits, see alignment E=1.1e-16 amino acids 207 to 382 (176 residues), 54.9 bits, see alignment E=6.9e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc02372)

Predicted SEED Role

"MFS family transporter protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92R82 at UniProt or InterPro

Protein Sequence (429 amino acids)

>SMc02372 transport transmembrane protein (Sinorhizobium meliloti 1021)
MLANFASVFSLMLSTFLMMVAFGLQSYVIPVRSVAESWSTLTISIFATGYTLGFTLSCIV
TPKFVLRVGHVRVFTALITLLSIAILMCGLVVDWRAWIGFRAVSGFAIAGSYLVIESWLN
ERVTNENRGLLFSLYLITTMVGTIGGQYLVPLGDPSNTSLFILCGVLFSLALLPTALSSS
PMPAPPARANFDIPALYRRSPVAVVGGFLAGALSGAWLNLGGVFTQKIGLSTGEGATLLA
SLLAGSAISQVPIGRASDRMDRRIVMVACGIAGVVSCLAMSVSIASSPPVLYALAACIGT
VLFPIYALNVAHANDLARPDEYVEISSGLMITYGLGTISGPLMVGPVMDRFGPVALFIAL
AVYFALYSGYAAWRILQREQHDGLVAKTDFQATTVLPTPGPDVTGPLAQQDAGELIEDDT
VPAWEQRAE