Protein Info for SMc02360 in Sinorhizobium meliloti 1021

Annotation: branched chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 249 to 278 (30 residues), see Phobius details amino acids 291 to 316 (26 residues), see Phobius details PF02653: BPD_transp_2" amino acids 31 to 314 (284 residues), 102.4 bits, see alignment E=1.2e-33

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to smk:Sinme_2638)

Predicted SEED Role

"FIG01076404: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MM6 at UniProt or InterPro

Protein Sequence (342 amino acids)

>SMc02360 branched chain amino acid ABC transporter permease (Sinorhizobium meliloti 1021)
MKHSYFTALILIGVIVIIAVGSQLLGIRLYDRIATNLLISLVLVIGLQTFMGNSGLLSFA
HIGFMGLGAYTSAVLTIPAQMKGMALPDLYEFMKVVEVSPLLAMLAAGVLAAVVAAIVAY
PLMRLSDAASVITSFALLVVLYTVMNNWSAFTNGPRTLFGLPKTTDMPVAAIVAAIVVVV
ALAFKESRTGKLLRASREDEVAAAALGADIPQLRWRAFILAAFIAGIGGALWGHFITSFA
PKAFYLKETFLIITMLVIGGANTVTGAVAGTILVTFAYEGLRGTEGALNATALGAGQVVG
LTEIVLALAMIAVMIVKPGGLFPNREIGHILTRARRKKETVA