Protein Info for SMc02359 in Sinorhizobium meliloti 1021

Annotation: high-affinity branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 37 to 53 (17 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 279 (271 residues), 121.9 bits, see alignment E=1.4e-39

Best Hits

Swiss-Prot: 31% identical to LIVH_SALTY: High-affinity branched-chain amino acid transport system permease protein LivH (livH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to smk:Sinme_2637)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MM7 at UniProt or InterPro

Protein Sequence (296 amino acids)

>SMc02359 high-affinity branched-chain amino acid ABC transporter permease (Sinorhizobium meliloti 1021)
MAFAIQFVIDVLSLGGAYALMALGLVIIYGILRLVNFAYGELIMVAGYTMFLASGSGLPW
IVMAVLAVGMAILFGIITDYAAFRPVRAKSVTAVLITSFAFSNLLQNAALLFISPRPRNV
PLPDIFSQTVSIGGAITPVRNLITIAASIALLAGVAFLMRRTTLGIAMRAAATNFTMARM
LGVPANLIISSAFALSGFLAGVVGILWIGRIGTVVPGIGLEPLLVAFIATVIGGMRSLPG
AVVGGFLLALIDTTLNYTLSQDLLKFRDAFTFSLVILILLWRPDGLIRGPASGQRT