Protein Info for SMc02339 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 227 to 249 (23 residues), see Phobius details PF00106: adh_short" amino acids 12 to 204 (193 residues), 175.6 bits, see alignment E=1.7e-55 PF08659: KR" amino acids 14 to 176 (163 residues), 47.7 bits, see alignment E=3.5e-16 PF13561: adh_short_C2" amino acids 20 to 254 (235 residues), 203 bits, see alignment E=1.2e-63

Best Hits

Swiss-Prot: 65% identical to GDH_RHIL3: Galactitol 2-dehydrogenase (gdh) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2618)

Predicted SEED Role

"putative short-chain dehydrogenase/reductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MP6 at UniProt or InterPro

Protein Sequence (256 amino acids)

>SMc02339 oxidoreductase (Sinorhizobium meliloti 1021)
MYLERFRLDGELAVVTGGGRGIGLASADALGEAGARLAIIERDPALLEEAHAILQAKGYD
VSVHEGDVTDPARMQAIADELTVKGGASILVNNAGIALSDIPAEDMEDERWLKVIDVNLN
GVYWCSRAFGRHMLSAGRGSIVNVGSMSGFIVNRPQPQAHYNASKAAVHHLTKSLAAEWA
PRGVRVNAVAPTYIETPLNALVENDRPMLDRWLDSTPMARMGKDHEVASVILFLSSRAAS
LMTGSIVLADGGYTLW