Protein Info for SMc02321 in Sinorhizobium meliloti 1021

Updated annotation (from data): L-rhamnose isomerase (EC 5.3.1.14)
Rationale: Specifically important for: L-Rhamnose monohydrate. KEGG now annotates it as L-rhamnose isomerase, which is correct. The gene is cofit with SMc03003 (rhaK), which is probably rhamnulose kinase. It had been suggested that rhaK might be rhamnose kinase and that the isomerase might act on L-rhamnose 1-phosphate, but the S. meliloti rhaK is not a rhamnose kinase. See the PhD thesis of Damien M. R. Rivers (2015). (KEGG_correct)
Original annotation: sugar isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02629: L-rhamnose catabolism isomerase
  • amino acids 9 to 421 (413 residues), 910.6 bits, E=5.7e-279
• PF01261: AP_endonuc_2
  • amino acids 119 to 291 (173 residues), 32.4 bits, E=4e-12

Best Hits

Swiss-Prot: 100% identical to RHAL_RHIME: Probable sugar isomerase R00627 (R00627) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01820, [EC: 5.3.1.-] (inferred from 100% identity to sme:SMc02321)

Predicted SEED Role

No annotation

MetaCyc Pathways

• L-rhamnose degradation I (5/5 steps found)
• superpathway of fucose and rhamnose degradation (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Fructose and mannose metabolism
• Galactose metabolism
• Inositol phosphate metabolism
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.- or 5.3.1.14

Sequence Analysis Tools

See Q92S14 at UniProt or InterPro

Protein Sequence (430 amino acids)

>SMc02321 L-rhamnose isomerase (EC 5.3.1.14) (Sinorhizobium meliloti 1021)
MTLMISTSVLDAENASRRDALTRDYESLGDRLARRGIDIDAVKAKVAAYGVAVPSWGVGT
GGTRFARFPGPGEPRNIFDKLEDCAVIQQLTRATPAVSLHIPWDKVSDLGALKEKGSALG
LSFDAMNSNTFSDAPGQAHSYKFGSLSHTDSATRRQAIEHNLECVEIGKALGSKALTVWV
GDGSNFPGQSNFTRAFERYLDSMKAVYAALPDDWRIFTEHKMFEPAFYSTVVQDWGTNYL
IAQELGPKAFCLVDLGHHAPNVNIEMIVARLIQFKKLGGFHFNDSKYGDDDLDTGSIDPY
RLFLVFNELVDAETRAANGFDPAHMLDQSHNVTDPIESLMTSAMEVGRAYAQALIVDRKA
LAGYQEENDALMASETLKTAFRTDVEPILATARLENDGAIAPVAAYRASGYRARVAAERP
AVAGGGGGIV