Protein Info for SMc02265 in Sinorhizobium meliloti 1021

Annotation: preprotein translocase subunit SecD/SecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 844 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 365 to 386 (22 residues), see Phobius details amino acids 392 to 412 (21 residues), see Phobius details amino acids 418 to 438 (21 residues), see Phobius details amino acids 461 to 483 (23 residues), see Phobius details amino acids 489 to 513 (25 residues), see Phobius details amino acids 547 to 566 (20 residues), see Phobius details amino acids 666 to 686 (21 residues), see Phobius details amino acids 692 to 713 (22 residues), see Phobius details amino acids 719 to 740 (22 residues), see Phobius details amino acids 767 to 789 (23 residues), see Phobius details amino acids 797 to 822 (26 residues), see Phobius details PF07549: Sec_GG" amino acids 40 to 61 (22 residues), 22.6 bits, see alignment (E = 1.2e-08) amino acids 562 to 582 (21 residues), 27.2 bits, see alignment (E = 4.3e-10) TIGR01129: protein-export membrane protein SecD" amino acids 46 to 513 (468 residues), 437.8 bits, see alignment E=6.3e-135 PF21760: SecD_1st" amino acids 160 to 218 (59 residues), 93.2 bits, see alignment 1.1e-30 PF22599: SecDF_P1_head" amino acids 234 to 344 (111 residues), 136.8 bits, see alignment E=5.9e-44 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 276 to 506 (231 residues), 242 bits, see alignment E=9.7e-76 amino acids 628 to 812 (185 residues), 162.2 bits, see alignment E=2.4e-51 PF02355: SecD_SecF_C" amino acids 347 to 512 (166 residues), 52.8 bits, see alignment E=7.1e-18 amino acids 638 to 824 (187 residues), 201.7 bits, see alignment E=1.6e-63 TIGR00966: protein-export membrane protein SecF" amino acids 568 to 814 (247 residues), 232.4 bits, see alignment E=1.1e-72

Best Hits

KEGG orthology group: K12257, SecD/SecF fusion protein (inferred from 100% identity to smk:Sinme_0212)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1) / Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92S58 at UniProt or InterPro

Protein Sequence (844 amino acids)

>SMc02265 preprotein translocase subunit SecD/SecF (Sinorhizobium meliloti 1021)
MRTSRWAVLAYVAIIIFGCLAALPSVLTPAMREQVASVLPFEPVTLGLDLRGGSHLVLEV
DGAGLQKARLNSLLDDTRRVLRGERVSASSARISGNSVTVSIPDAQDRDKVLPKLQELAT
PVSTVGFAAPAPEVEVTTAGDVITLAMTEAGLADRMTKAVEQSLEIIRNRVDQVGVAEPL
IQRIGSNRILVQLPGLQDPTRLRELLGSTAQMSFHMLDQSVDVTQPAPRGVDILPGANDG
NRYPVESRVAISGERLDDAKVGFDQRTNQPVVDFSFDSLGARQFADITRENVGRPFAIVL
DGKVLTAPVINEPILGGRGQISGSFTVEEATVLSALLRSGALPAPLTIIEERSVGPNLGS
DSIRMGLFTGLAGFGLVVVLMVVLYGAWGMIANVGLVLHTIMTIGVLGLIGSTLTLPGIA
GIILGIGMAVDANILINARIREETEAGAGAMKALDIGFNKAYATIIDSNVTTLAGTVLLF
WFGSGPVKGFAVTMMLGIGISMFTSVTVVRLLMREVVVRRKMKKLEIPSLFGKVPQLPTF
SFMKGRFLAIGFSAFLSISSVILFFTPGLNYGIDFIGGIQVEAVSKEKINLPTLRQSLEE
LNLGEVALQDFGGGQSVLIRVQRQPGGEQAQTVALNKVKDAVTTAIPGASMERTEVVGPT
VSGELARSGFLAVALAMLAILLYIWFRFEWHFAVGAIAVLLLDITKTVGFFALTGIDFNL
TAIAALLTMIGYSVNDKVVVYDRMRENLRKYKSMPFSDLIDMSINQVIARCIFTSAATAL
SLVPMAIWGGEAVQSFAWPMIFGVIVATTSSIYIGGPILLFLSRWWKEREAARSAGQQAE
TPTA