Protein Info for SMc02260 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 PF00005: ABC_tran" amino acids 50 to 209 (160 residues), 118 bits, see alignment E=5e-38

Best Hits

Swiss-Prot: 64% identical to AOTP_PSEAE: Arginine/ornithine transport ATP-binding protein AotP (aotP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 100% identity to sme:SMc02260)

Predicted SEED Role

"Arginine/ornithine ABC transporter, ATP-binding protein AotP" in subsystem Arginine and Ornithine Degradation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92S62 at UniProt or InterPro

Protein Sequence (284 amino acids)

>SMc02260 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MLHERKTRGTVFHGFNERSANERSRAPMTDAAQAIAVTDLHKRFGPLEVLKGVSLSARQG
DVIAIIGGSGSGKSTLLRCINMLELPSAGQISVHGEEIRMKPDGHGGLMPADRKQVQRIR
TQLGMVFQSFNLWQHMTILQNVIEAPVHVLGKTKAEAVETAEALLRRVGLYEKRDAYPAF
LSGGQQQRAAIARALAIQPLVMLFDEPTSALDPELVGEVLSVIGDLAREERTMVLVTHEM
KFARDVANHIVFLHNGVIEEQGPPEAIFGAPKSERLKKFISSIH