Protein Info for SMc02259 in Sinorhizobium meliloti 1021

Annotation: periplasmic binding ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00497: SBP_bac_3" amino acids 28 to 254 (227 residues), 130 bits, see alignment E=7.6e-42 PF10613: Lig_chan-Glu_bd" amino acids 73 to 118 (46 residues), 40.4 bits, see alignment 4.4e-14

Best Hits

Swiss-Prot: 42% identical to ARGT_SALTY: Lysine/arginine/ornithine-binding periplasmic protein (argT) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_0206)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92S63 at UniProt or InterPro

Protein Sequence (260 amino acids)

>SMc02259 periplasmic binding ABC transporter protein (Sinorhizobium meliloti 1021)
MKKTLKLVALAAALAITGAATASAQQVKVGIAAEPYPPFTSPDASGNWEGWEIEFMKAMC
AEAKLDCVVTPVAWDGIIPALTSKKIDMIIGSMSITAERLKTIDFSDKYYNTPTGIIGAK
GDDIKPTPEGLAGKTIGVQVSTVHQAYAMKHFAPAGVEVKEYQTQDEANQDLAAGRVDAV
QADAIALDAFLKSDQGKQCCDYKGEVAEDVDVIGPGVGVGLRKGETELKEKVNAAIKAIR
ENGTYDAFSKKYFDFDIYGG