Protein Info for SMc02258 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 93 to 117 (25 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 22 to 128 (107 residues), 51.4 bits, see alignment E=6.6e-18 PF00528: BPD_transp_1" amino acids 43 to 234 (192 residues), 83.2 bits, see alignment E=9.8e-28

Best Hits

Swiss-Prot: 42% identical to HISQ_ECOLI: Histidine transport system permease protein HisQ (hisQ) from Escherichia coli (strain K12)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to smk:Sinme_0205)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92S64 at UniProt or InterPro

Protein Sequence (241 amino acids)

>SMc02258 ABC transporter permease (Sinorhizobium meliloti 1021)
MLGDSFINWSLLSLSAPGWGGVLLQGFLSSIEIAVGGYALGLALGIGGAFGKLYGGPVLR
DLLECYTTVVRAVPELVLILLLYYAGTDLLNQLLGAIGVGAVDISGLVAGIFVIGVVQGA
YSTEVLRGAIKAVPAGQIEAARAYGMSPLLVLRRITLPAMLPYAIPGLANLWLIATKDTA
LLAVVGFSELTLVTRQAAGATKAYLLFFCAAGALYLALTLVSNVFIGMLERHARRGFAEQ
R