Protein Info for SMc02255 in Sinorhizobium meliloti 1021

Annotation: quinol oxidase subunit I transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 245 to 262 (18 residues), see Phobius details amino acids 345 to 369 (25 residues), see Phobius details amino acids 381 to 402 (22 residues), see Phobius details amino acids 427 to 454 (28 residues), see Phobius details PF01654: Cyt_bd_oxida_I" amino acids 33 to 459 (427 residues), 554.7 bits, see alignment E=5.6e-171

Best Hits

KEGG orthology group: K00425, cytochrome bd-I oxidase subunit I [EC: 1.10.3.-] (inferred from 100% identity to sme:SMc02255)

MetaCyc: 59% identical to cyanide insensitive ubiquinol oxidase subunit I (Pseudomonas putida KT2440)
RXN-6883 [EC: 1.10.3.11]

Predicted SEED Role

"putative Cytochrome bd2, subunit I" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 1.10.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92S67 at UniProt or InterPro

Protein Sequence (493 amino acids)

>SMc02255 quinol oxidase subunit I transmembrane protein (Sinorhizobium meliloti 1021)
MQIADIRRRSRLSLRFPPERISAVFEAFDATVLARIQFAFTVSFHIIFPAFSIGLASYLA
VLEALWLWKKDEVYLELFNFWKTIFAVAFGMGVVSGIVMSYQFGTNWSVFSDKAGPVIGP
LMGYEVLTAFFLEAGFLGVMLFGLNRVGPKLHFFATAMVALGTLISATWILAVNSWMQTP
AGFSVNEAGQFIPDDWWAVIFNPSFPYRLTHMVLAAYLTTAFVVGACGAWHLLRKTAPRR
ARTMFSMAMWMAAIVAPIQIFAGDQHGLNTLEHQPAKVMAMEGHYQSHPEGAPLILFGMP
NSAEKRVDYALEIPKLSSLILKHSLDAPLAGLDTIPEDRHPPVAIVFWSFRVMVAIGFAM
LGLGLWSLWCRLRGTLDTNAALHRAAVLMGPAGFVAVLAGWITTEVGRQPYTIYGHLLTA
DSISPIAAPAVGASLVAFIIVYFLVFGAGTFYILRLMARLPRDTMPELDEGPLRTAGVTP
GPATANQGGHHGH