Protein Info for SMc02253 in Sinorhizobium meliloti 1021

Annotation: salicylate biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 TIGR01803: chorismate mutase related enzymes" amino acids 11 to 92 (82 residues), 136.1 bits, see alignment E=1.8e-44 PF01817: CM_2" amino acids 14 to 92 (79 residues), 62.2 bits, see alignment E=2.2e-21

Best Hits

KEGG orthology group: K04782, isochorismate pyruvate-lyase [EC: 4.1.3.-] (inferred from 100% identity to smk:Sinme_0200)

Predicted SEED Role

"Isochorismate pyruvate-lyase (EC 4.-.-.-)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 4.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.-

Use Curated BLAST to search for 4.-.-.- or 4.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92S69 at UniProt or InterPro

Protein Sequence (101 amino acids)

>SMc02253 salicylate biosynthesis protein (Sinorhizobium meliloti 1021)
MQKTPAECTTMADIRVEIDRLDRALMTLFAERWGYIERAAEIKRPLNLKADIPARVAEVK
ENARRNAVELGLDPDFYERFWGQLVERAIAHERKLLGEDDA