Protein Info for SMc02245 in Sinorhizobium meliloti 1021

Annotation: dihydroorotate dehydrogenase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 TIGR01036: dihydroorotate dehydrogenase (fumarate)" amino acids 7 to 348 (342 residues), 391.5 bits, see alignment E=1.4e-121 PF01180: DHO_dh" amino acids 45 to 336 (292 residues), 279.9 bits, see alignment E=1.1e-87

Best Hits

Swiss-Prot: 100% identical to PYRD_RHIME: Dihydroorotate dehydrogenase (quinone) (pyrD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00226, dihydroorotate dehydrogenase (fumarate) [EC: 1.3.98.1] (inferred from 99% identity to smk:Sinme_0192)

Predicted SEED Role

"Dihydroorotate dehydrogenase (EC 1.3.3.1)" in subsystem De Novo Pyrimidine Synthesis (EC 1.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.1 or 1.3.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92S77 at UniProt or InterPro

Protein Sequence (362 amino acids)

>SMc02245 dihydroorotate dehydrogenase 2 (Sinorhizobium meliloti 1021)
MIGQLEHLARRGLFLFDPEAAHGLSIKALKSGLVPSCAAPADPRLGQTVAGLVFSNPIGM
AAGYDKNAEVPEALLKIGFGFTEIGTVTPRPQAGNDKPRLFRLVEDEAVINRLGFNNEGH
GAALARLKACSREALIGVNIGANKDSADRIADYVTGIRTFYAVARYFTANISSPNTPGLR
DLQARESLSALLSAVLAARDDEARKGGRQVPVFLKIAPDLTEEGMDDIAAEVLAHGLDGL
IVSNTTLSREGLKDRRQANEAGGLSGKPLFEKSTAVLARMRKRVGPHLPIIGVGGVCSAE
TAAEKIRAGADLVQLYSCMIYEGPGLPGRIVRGLSALCEREKLASIRDIRDSRLDYWSGR
NV