Protein Info for SMc02244 in Sinorhizobium meliloti 1021

Annotation: transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 59 to 82 (24 residues), see Phobius details amino acids 103 to 131 (29 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details amino acids 328 to 350 (23 residues), see Phobius details amino acids 367 to 390 (24 residues), see Phobius details amino acids 400 to 419 (20 residues), see Phobius details amino acids 425 to 443 (19 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 32 to 425 (394 residues), 228 bits, see alignment E=9.4e-72 PF01554: MatE" amino acids 32 to 192 (161 residues), 66.9 bits, see alignment E=9.1e-23 amino acids 256 to 407 (152 residues), 55 bits, see alignment E=4.2e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_0191)

Predicted SEED Role

"DNA-damage-inducible protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92S78 at UniProt or InterPro

Protein Sequence (455 amino acids)

>SMc02244 transmembrane protein (Sinorhizobium meliloti 1021)
MTATQSLERDTDNPEAGPFLVTNRLIFSIALPMTLGFLTTPLLGLVDTAVVGRLGQAELL
AGLAVGAVMFDLIFTTFNFLRAATTGLVAQAYGRGDRREQQAVFWRSLMIALVTGAAIVL
ISPILLSAGLWLMGPGPEVAEVTRTYFLYRILSGPAALANYAILGFVLGRGEGTLGLMLQ
TLINGTNIVLSILLGLFLGWGVAGVAIGTVAGEVIGALAGFAIVYGRFDSKDAPGWAMIF
ARDRLKKLFGLNRDIMIRSFALLAAFTLVTRIGTSFGPVTLAANAVLMTIFLVAGYYLDG
LATAAEQLTGRSIGAGYRPAFDRVLRMTALWSLGLAALTTLALLAFGNAVVNMLTTAPDV
RALAYQYMPWAAVTALTGALAFLMDGVFIGAGWSRDMRNMMLAAFIGYVAALAVLVPAFG
NHGLWAGLNLFLLLRGAFLLLMIPRRAAQTFRPLQ