Protein Info for SMc02237 in Sinorhizobium meliloti 1021

Updated annotation (from data): DNA damage response helicase, ligase-associated
Rationale: Conserved and specific phenotype: important for resisting cisplatin. Related to Lhr, which is either a DNA:DNA or DNA:RNA helicase, but lacks the long C-terminal extension that might have a regulatory role (see putative winged helix domain in E. coli lhr). This is also related to the archael protein saci_1500, which has also been linked to DNA damage response, as a mutant is sensitive to UV (PMID: 26148716)
Original annotation: ATP-dependent helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 849 TIGR04121: DEXH box helicase, DNA ligase-associated" amino acids 23 to 837 (815 residues), 1106.7 bits, see alignment E=0 PF00270: DEAD" amino acids 36 to 211 (176 residues), 99.4 bits, see alignment E=3.9e-32 PF00271: Helicase_C" amino acids 270 to 367 (98 residues), 58.4 bits, see alignment E=1.7e-19 PF19306: Lhr_WH" amino acids 411 to 564 (154 residues), 115 bits, see alignment E=5.6e-37 PF08494: DEAD_assoc" amino acids 620 to 809 (190 residues), 186.4 bits, see alignment E=1e-58

Best Hits

KEGG orthology group: K03724, ATP-dependent helicase Lhr and Lhr-like helicase [EC: 3.6.4.-] (inferred from 100% identity to sme:SMc02237)

Predicted SEED Role

"FIG003033: Helicase domain protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92S82 at UniProt or InterPro

Protein Sequence (849 amino acids)

>SMc02237 DNA damage response helicase, ligase-associated (Sinorhizobium meliloti 1021)
MFSVDRIDSPSPEGDALTLPAPFLRWFAEKGWRPRAHQLELLSRAEAGESTLLIAPTGAG
KTLAGFLPSLVDITRRGRIPPGAPFTGIHTLYISPLKALAVDIERNLMKPVGEMGLPVSI
ENRTGDTPQGKRQRQKLNPPDILLTTPEQLALLLANGEAERFFKDLRYVVLDELHSLVMS
KRGHLLSLGLARLRRLAPRLQTMGLSATVADPMDLQRWLVAQFLAKENHAGLITVSGGAK
PEISILRTENQVPWAGHSARYAIPDVYAAIKEHRTTLLFVNTRSQAEMLFQELWKINDDD
LPIALHHGSLDVAQRRRVEAAMAENRLRAVVATSTLDLGIDWGDVDLVVHVGAPKGASRL
AQRIGRANHRMDEPSRAILVPANRFEVMECQAALDANYVGAQDTPSIGKGALDVLAQHIL
GMACAQPFDALELYEEVISAAPYARLAWETFERAVDLVATGGYALRTYERYARIRKTKDG
LWRVSNPMVAQQYRLNVGTIVESPMLNIRMVKRNQRGSLGRGGMSLGKVEESFLEMLSPG
DTFLFSGKVLRFEGIRENECLVSQAFSFDPKVPSYAGGKFPLSTYLAAQVRKMLADPARR
AGLPDQVRDWLALQGDVSMLPRDDELLIETFPRGSRHYMVIYAFEGRLAHQTLGMLLTRR
LDRAGLKPLGFVATDYSLAVWALDDMGAAFRARAPSLGQLFDEDMLGDDLEAWLNESFLL
KRTFRNCAVIAGLIEQRHPGREKTGRQITVSADLIYDVLRAHEPDHILLEATRNDAATGL
LDIGRLGSMLKRIKGHITHRRLDQISPLAIPVMLEIGRESVHGEAQDFLLTEAADDLINE
AMGGHGTDG