Protein Info for SMc02217 in Sinorhizobium meliloti 1021

Annotation: O-succinylhomoserine sulfhydrylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 53% identical to METZ_MYCTU: O-succinylhomoserine sulfhydrylase (metZ) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K10764, O-succinylhomoserine sulfhydrylase [EC: 2.5.1.-] (inferred from 100% identity to sme:SMc02217)

MetaCyc: 37% identical to Cys3 (Saccharomyces cerevisiae)
Cystathionine gamma-lyase. [EC: 4.4.1.1]

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48, EC 2.5.1.49)

MetaCyc Pathways

aspartate superpathway (23/25 steps found)
superpathway of branched chain amino acid biosynthesis (17/17 steps found)
superpathway of L-isoleucine biosynthesis I (13/13 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
glycine betaine degradation I (7/8 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
superpathway of L-threonine metabolism (14/18 steps found)
L-methionine degradation II (3/3 steps found)
L-serine degradation (3/3 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
L-threonine degradation I (5/6 steps found)
L-homocysteine biosynthesis (2/2 steps found)
superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
L-methionine biosynthesis III (3/4 steps found)
D-serine degradation (2/3 steps found)
L-cysteine degradation II (2/3 steps found)
L-tryptophan degradation II (via pyruvate) (2/3 steps found)
L-methionine biosynthesis II (4/6 steps found)
superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)
L-cysteine biosynthesis III (from L-homocysteine) (1/2 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (3/5 steps found)
L-methionine biosynthesis I (3/5 steps found)
superpathway of L-cysteine biosynthesis (mammalian) (3/5 steps found)
homocysteine and cysteine interconversion (2/4 steps found)
L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
glycine betaine degradation III (4/7 steps found)
purine nucleobases degradation II (anaerobic) (16/24 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)
felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
L-mimosine degradation (4/8 steps found)
superpathway of L-methionine salvage and degradation (9/16 steps found)
glutathione-mediated detoxification I (3/8 steps found)
hydrogen sulfide biosynthesis II (mammalian) (1/6 steps found)
hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-, 2.5.1.48, 2.5.1.49

Use Curated BLAST to search for 2.5.1.- or 2.5.1.48 or 2.5.1.49 or 4.4.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92S95 at UniProt or InterPro

Protein Sequence (394 amino acids)

>SMc02217 O-succinylhomoserine sulfhydrylase (Sinorhizobium meliloti 1021)
MSKNWRPATQLVHGGTLRSQYGETSEAIFLTQGFVYDSSEAAEARFKGETDGFIYARYGS
PTNDMFEKRMCMLEGAEDARATASGMAAVSAAILCQVKAGDHIVAARALFGSCRWVVETL
APKYGVECTLVDGRDLKNWEDAVRPNTKVFFLESPTNPTLEVIDIAGVARLADQIGAKVV
VDNVFATPLFQKPLELGAHVVVYSATKHIDGQGRCLGGVVLSDKQWVDENLHDYFRHTGP
AMSPFNAWTLLKGIETLPLRVKQQTESARRVADFLAEQPQVARVIYPGRKDHPQADVIAK
QMSGGSTLVAFELKGGKEAAFALQNALEIIRISNNLGDSKSLITHPATTTHKNLTDEARA
ELGISAGTVRFSAGIEDSEDLIEDFARALKGVNA