Protein Info for SMc02176 in Sinorhizobium meliloti 1021

Annotation: adenylate cyclase transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 623 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details amino acids 27 to 27 (1 residues), see Phobius details transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 109 to 124 (16 residues), see Phobius details amino acids 268 to 285 (18 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details amino acids 372 to 372 (1 residues), see Phobius details amino acids 374 to 394 (21 residues), see Phobius details PF05226: CHASE2" amino acids 19 to 316 (298 residues), 119.1 bits, see alignment E=2.7e-38 PF00211: Guanylate_cyc" amino acids 432 to 609 (178 residues), 72.8 bits, see alignment E=3e-24

Best Hits

KEGG orthology group: K01768, adenylate cyclase [EC: 4.6.1.1] (inferred from 100% identity to sme:SMc02176)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SD3 at UniProt or InterPro

Protein Sequence (623 amino acids)

>SMc02176 adenylate cyclase transmembrane protein (Sinorhizobium meliloti 1021)
MHHRITPLSGGIIASLAAALLLYLYAGTILDTQRELFFDSLTQWVPSPRSPDIIVVDVDR
KAYEAHGGSWDRAATADLITRLAAAGPKTIAVDFVFSSACDPASPANAALAAAIGRAPVA
LGFLAADRVLARPRPVPPLALRRQLAVPAQWFIEGAETSCPAFMDRAKAATAAFLVGDED
ARVRRVQAYAILGNDAYPALGIEAGRLAADSSTPVLGGEPAWLRLDHAIIPLDESGNLRF
PASSGEAIAARTISAADILAGRLEKSRLAGRLVLIGSSMPSLGGLRPTASMPLQPSVQIH
ADIANAIMTGFVPYRGSNLPLIEAVFAFAAGVAAAYAATRLRPMASLMLGAAAVLATIAF
AGAIYASTGWLFDAVGTSLALAAVLIVTSALQLARTRRAEAIARRKFSQYLPQSVVARYI
DEPDRGRMAGEERPVTALFTDIEGFSTVSQKLGPRELVALLDIYFAEVNALVSGHGGMVD
KVVGDAVHALFNAPEDLPGHVDKAIGCAAAIHALTEEMRRRPQFAEHGFGRTRIGIETGP
AVLGEVGAGGKLDYTAHGDAVNLAARLQEANKFLGTAICIGPAAAAQSKAALRSLGRHDI
RGFGSMELFTVAGDGLNKHLGAE