Protein Info for SMc02165 in Sinorhizobium meliloti 1021

Annotation: orotate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00336: orotate phosphoribosyltransferase
  • amino acids 19 to 186 (168 residues), 113 bits, E=6.6e-37
• PF00156: Pribosyltran
  • amino acids 62 to 155 (94 residues), 41.8 bits, E=3.5e-15

Best Hits

Swiss-Prot: 100% identical to PYRE_RHIME: Orotate phosphoribosyltransferase (pyrE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 100% identity to sme:SMc02165)

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• UMP biosynthesis II (6/6 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• UMP biosynthesis I (5/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.10

Sequence Analysis Tools

See Q92SC6 at UniProt or InterPro

Protein Sequence (232 amino acids)

>SMc02165 orotate phosphoribosyltransferase (Sinorhizobium meliloti 1021)
MFSNAFTDKAVMAELVAKMLWEIKAVHFRADEPYRLASGMASPVYIDCRKLVSYPRIRSA
VMDFAAATILREAGFEQFDVVAGGETAGIPFAAMLAERLGLPMIYVRKAPKGHGRNAQIE
GYMPEGARVLVIEDLTTAGGSMFKFIDAIRAAGGVVEHGIALFYYDIFPEARGNMKSKGV
DLHYIATWRNVLAVARELALFDEKTLNEVEAFLNAPLDWSGRNGGVRALAVQ