Protein Info for SMc02160 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 72 to 95 (24 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 129 to 153 (25 residues), see Phobius details amino acids 220 to 246 (27 residues), see Phobius details amino acids 274 to 304 (31 residues), see Phobius details amino acids 310 to 339 (30 residues), see Phobius details amino acids 344 to 360 (17 residues), see Phobius details amino acids 380 to 410 (31 residues), see Phobius details PF01594: AI-2E_transport" amino acids 83 to 413 (331 residues), 114.3 bits, see alignment E=3.6e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc02160)

Predicted SEED Role

"putative permease transmembrane transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SC2 at UniProt or InterPro

Protein Sequence (436 amino acids)

>SMc02160 ABC transporter permease (Sinorhizobium meliloti 1021)
MRVFSRKAPIRSRPPSLRRKPRPAERNGLARLRVCCKVRRDGGELVQLGNRDRENLPVEP
RLFGQPAHSRSALVVPISAARWLLVLILLCGVYFFHGFLVPVLAAVVIGFASWPIYWRLL
QGLNGNRTLAATIAIISVVAFIVVPISLAAIYAVEEVRDWLVWAVATNANGAPAPAWLAT
IPAVGAWLGEQWVKYVGHPGALGELVQLVSGSNIGNIYRGVLVVGASAFQSFLTLLFMLI
TLFFVYRDGQSFSKQLDHLGERIFPMRWERLSRVVPLTISSTVTGMGIIAIGEGIVLGVA
YWLAGVPSPVTLGILTGIMALIPGGAPLCFTLVSVYLVASGSPVHGIALFTWGTTELFIV
DKTLRPRLVGGPIKLPFLPTFFGLIGGVKTMGFLGLFVGPVLMALLVAIWREWLREVTSQ
PEPPVNGISRVDISAK