Protein Info for SMc02157 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 50 to 78 (29 residues), see Phobius details amino acids 95 to 112 (18 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details PF01148: CTP_transf_1" amino acids 46 to 311 (266 residues), 207.8 bits, see alignment E=1.4e-65

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 100% identity to sme:SMc02157)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.41

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SB9 at UniProt or InterPro

Protein Sequence (313 amino acids)

>SMc02157 hypothetical protein (Sinorhizobium meliloti 1021)
MSLNDKLFILFAGIAALLGAASLIGFVLARRATSETGRATIDNLNARIRAWWVMIAIFAV
SFTLGRGVTLVLFALTSFYTLREFVSLTPTRAADHLPLVASFYVLLPLQYWLISIDWYAL
FTILIPVYGFLLLPSLSALKGDTEQFLLRVSRIQWGLMLTVYCISHAPALLTLDIPGRAG
EGFLLLFFLITIAQFSDVMQYVFGKLFGRTKVAPVVSPSKTVEGLAGGGLSAVAAGAALW
WITPFTPLEAAAMAFAIVAMGFLGGLALSAVKRSMGVKDWGSMISGHGGVLDRMDSLSFA
APVFFHLTRYFYT