Protein Info for SMc02147 in Sinorhizobium meliloti 1021

Annotation: phosphate regulon sensor histidine kinase transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 28 to 60 (33 residues), see Phobius details TIGR02966: phosphate regulon sensor kinase PhoR" amino acids 81 to 420 (340 residues), 375.7 bits, see alignment E=9e-117 PF00512: HisKA" amino acids 198 to 263 (66 residues), 70.4 bits, see alignment E=1.6e-23 PF02518: HATPase_c" amino acids 311 to 419 (109 residues), 92.1 bits, see alignment E=4.7e-30 PF13581: HATPase_c_2" amino acids 318 to 400 (83 residues), 27.5 bits, see alignment E=4.3e-10

Best Hits

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 100% identity to smk:Sinme_0153)

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SA5 at UniProt or InterPro

Protein Sequence (420 amino acids)

>SMc02147 phosphate regulon sensor histidine kinase transmembrane protein (Sinorhizobium meliloti 1021)
MRNEDIVLDGAKVFWRTLLPRLKAERGLLGLSVVLAFLAALAGIHPLAVLPFWIVLVAAI
LNRGAPPVQTAPASVGAAVETKADPLAPLLDALDMPVLVVAADETVVFQNAAAEKAFGTI
PQDSYLSARVRSPGILDMVRETIATGKVNQIEHAERLPSEAVYVVRVAPVDIGSDVSGRR
IFLLTYRDISQARRIDRMRSDFVANASHELRTPLASLRGFIETLQGPARDDRKAQEKFFG
IMHEQVTRMSRLVDDLLSLSRLELKSHIAPDDAVDLGPLLGHVRDSLAPLAGELDVTIAL
EVPETPVFVQGDRDELVEVFENLIENACKYGQEGKQVDVRLTGGNGHQAEVTVTDHGPGI
PAEHVPRITERFYRVNVEASRSKKGTGLGLAIVKHILTRHRARLLIHSEVGKGTVFKVRF