Protein Info for SMc02137 in Sinorhizobium meliloti 1021

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF02729: OTCace_N" amino acids 3 to 143 (141 residues), 169.2 bits, see alignment E=6.5e-54 TIGR00658: ornithine carbamoyltransferase" amino acids 3 to 300 (298 residues), 383.5 bits, see alignment E=3.3e-119 PF00185: OTCace" amino acids 149 to 299 (151 residues), 176.9 bits, see alignment E=3.2e-56

Best Hits

Swiss-Prot: 100% identical to OTC_RHIME: Ornithine carbamoyltransferase (argF) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SMc02137)

MetaCyc: 56% identical to ArgF (Bacillus subtilis)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.3.3

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92S99 at UniProt or InterPro

Protein Sequence (303 amino acids)

>SMc02137 ornithine carbamoyltransferase (Sinorhizobium meliloti 1021)
MTRHFLDLSAMTATDLRTIIDDARVRKSATKAGTAEKPLAGKMLAMIFEKPSTRTRVSFD
VGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTDHRRLLEMAEHATVP
VINGLTDDTHPCQIMADILTFEEHRGPVKGKTIAWTGDGNNVLHSLIEGSARFGYRMNMA
VPLGSEPHDKFLNWARNNGAEVLLSHEAEQAVAGAHCVVTDTWISMNQEHRARGHNVFQP
YQVNGALMKHAAPDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAWCM
GAV