Protein Info for SMc02134 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 32 to 60 (29 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 28 to 157 (130 residues), 31.4 bits, see alignment E=1.2e-11

Best Hits

Swiss-Prot: 47% identical to YNJF_ECOLI: Inner membrane protein YnjF (ynjF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_0165)

Predicted SEED Role

"Putative phosphatidylglycerophosphate synthase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92S96 at UniProt or InterPro

Protein Sequence (203 amino acids)

>SMc02134 hypothetical protein (Sinorhizobium meliloti 1021)
MLDGALRRRLDPVLDRLGAALAGRGVSADAVTILGLCLGLAAALLIGLGAYLPAAALILV
SRLCDGLDGAVARASRKTDFGGFLDIVLDFTFYGAVPLGFIIADPAANGLAGGFLLFAFY
VNGASFLAYAVMAEKRALTTAVRGAKSLYFTTGLAEATETIVFFLLSCLFPGWFPLFATV
FALVCLYTALSRIVLARLTFRQD