Protein Info for SMc02121 in Sinorhizobium meliloti 1021

Updated annotation (from data): ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component
Rationale: Very important for histidine and glutamine utilization and also for lysine utilization. It could be the ATPase component for lysine transport by Smc00140:Smc00138 as well (as there is no ATPase component in that gene cluster or other ATPase component identified in the fitness data)
Original annotation: general L-amino acid transport ATP-binding ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00005: ABC_tran" amino acids 34 to 182 (149 residues), 131.7 bits, see alignment E=2.8e-42 PF13304: AAA_21" amino acids 152 to 213 (62 residues), 27.8 bits, see alignment E=2.5e-10

Best Hits

Swiss-Prot: 92% identical to AAPP_RHIL3: General L-amino acid transport ATP-binding protein AapP (aapP) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K09972, general L-amino acid transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to smk:Sinme_1278)

MetaCyc: 60% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"ABC-type polar amino acid transport system, ATPase component"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Q74 at UniProt or InterPro

Protein Sequence (258 amino acids)

>SMc02121 ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (Sinorhizobium meliloti 1021)
MANTATAPKLAVSTTDVAIEITNMNKWYGDFHVLRDINLRVMRGERIVVAGPSGSGKSTM
IRCINRLEEHQKGKIVVDGIELTNDLKKIDEVRREVGMVFQHFNLFPHLTILENCTLAPI
WVRKMPKKEAEQVAMHFLERVKIPEQALKYPGQLSGGQQQRVAIARSLCMRPKILLFDEP
TSALDPEMVKEVLDTMVGLAEEGMTMICVTHEMGFARQVANRVIFMDQGQIVEQNSPAEF
FDNPQHERTKLFLSQILH