Protein Info for SMc02119 in Sinorhizobium meliloti 1021

Updated annotation (from data): ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 1
Rationale: Specific phenotypes on L-Glutamine; L-Histidine. Mild phenotypes on proline or lysine (KEGG_correct)
Original annotation: general L-amino acid transport permease ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 89 to 116 (28 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 220 to 246 (27 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details amino acids 339 to 357 (19 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 88 to 151 (64 residues), 53.6 bits, see alignment E=1.3e-18 PF00528: BPD_transp_1" amino acids 219 to 392 (174 residues), 38 bits, see alignment E=7.6e-14

Best Hits

Swiss-Prot: 71% identical to AAPQ_RHIL3: General L-amino acid transport system permease protein AapQ (aapQ) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K09970, general L-amino acid transport system permease protein (inferred from 100% identity to smk:Sinme_1280)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Q72 at UniProt or InterPro

Protein Sequence (397 amino acids)

>SMc02119 ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 1 (Sinorhizobium meliloti 1021)
MAIGVTNAPERSRSSGSIINDPQVRGIFYQAITIIILAALIYWIVDNTVDNLRRANIASG
YDFVRSRAGFDVGQSLISFTSDSTYGRALLVGFINTLLVAITGIITATIIGFIVGIGRLS
HNWIIAKLSLAYVEVFRNIPPLLVIFFWYSGVLSILPQARDALALPFDIFLSNRGVAFPR
PIAEEGAEYTLLAFVIAVAASVFFARYARKRQLATGERLPVLWTVLGLIIGLPLVTFLVT
GAPITFDIPVAGKFNLTGGSVVGPEFMSLFLALSFYTAAFIAEIVRAGIRGVSKGQTEAA
HALGIRPALTTRLVVVPQAMRIIIPPLTSQYLNLTKNSSLAVAIGYADLVAVGGTILNQT
GQSIEIVSIWLIVYLSLSLATSLFMNWYNARMALVER