Protein Info for SMc02113 in Sinorhizobium meliloti 1021

Annotation: serine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06426: SATase_N
  • amino acids 19 to 123 (105 residues), 127.5 bits, E=2.5e-41
• TIGR01172: serine O-acetyltransferase
  • amino acids 92 to 252 (161 residues), 230.1 bits, E=6.9e-73
• PF00132: Hexapep
  • amino acids 203 to 237 (35 residues), 33.5 bits, 2.4e-12

Best Hits

Swiss-Prot: 49% identical to CYSE_HAEIN: Serine acetyltransferase (cysE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00640, serine O-acetyltransferase [EC: 2.3.1.30] (inferred from 100% identity to sme:SMc02113)

MetaCyc: 47% identical to serine acetyltransferase (Arabidopsis thaliana col)
Serine O-acetyltransferase. [EC: 2.3.1.30]

Predicted SEED Role

"Serine acetyltransferase (EC 2.3.1.30)" in subsystem Conserved gene cluster possibly involved in RNA metabolism or Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.3.1.30)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• L-cysteine biosynthesis I (2/2 steps found)
• L-cysteine biosynthesis VII (from S-sulfo-L-cysteine) (2/4 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• seleno-amino acid biosynthesis (plants) (2/5 steps found)
• N-3-oxalyl-L-2,3-diaminopropanoate biosynthesis (1/4 steps found)
• D-cycloserine biosynthesis (1/6 steps found)
• superpathway of seleno-compound metabolism (7/19 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.30

Sequence Analysis Tools

See Q92Q66 at UniProt or InterPro

Protein Sequence (275 amino acids)

>SMc02113 serine acetyltransferase (Sinorhizobium meliloti 1021)
MVAKTELRHTESLEAIDPIWDSLREEARLAAERDPMLAAFLYSTVVNQHSLEDCVIYRIC
ERLDHPDLQASLLHQTFAEMLEDWPEWGAVLRVDIQAVYDRDPACTRFMEPVLYFKGFHA
IQTHRLAHWLWNRGRKDFALYLQSRSSSVFQTDINPAARIGRGIFLDHATGLVVGETAVI
GDNVSILHGVTLGGTGKEGSDRHPKIGNGVLIGAGAKILGNIHIGHCSRVAAGSVVLKAV
PPKSTVAGVPAKVVGEAGCSEPSRQMDQILASFDI