Protein Info for SMc02109 in Sinorhizobium meliloti 1021

Annotation: ATP-dependent Clp protease ATP-binding subunit protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 838 TIGR02639: ATP-dependent Clp protease ATP-binding subunit ClpA" amino acids 5 to 748 (744 residues), 1155.6 bits, see alignment E=0 PF02861: Clp_N" amino acids 15 to 64 (50 residues), 45 bits, see alignment 5.8e-15 PF00004: AAA" amino acids 225 to 357 (133 residues), 47.2 bits, see alignment E=1.9e-15 amino acids 506 to 623 (118 residues), 45.6 bits, see alignment E=5.8e-15 PF17871: AAA_lid_9" amino acids 365 to 465 (101 residues), 89.9 bits, see alignment E=5.6e-29 PF07724: AAA_2" amino acids 500 to 660 (161 residues), 189 bits, see alignment E=4e-59 PF07728: AAA_5" amino acids 507 to 622 (116 residues), 45.9 bits, see alignment E=3.6e-15 PF10431: ClpB_D2-small" amino acids 670 to 747 (78 residues), 91.4 bits, see alignment E=1.9e-29

Best Hits

Swiss-Prot: 72% identical to CLPA_RHOBL: ClpA homolog protein from Rhodobacter blasticus

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 88% identity to ara:Arad_2212)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Q62 at UniProt or InterPro

Protein Sequence (838 amino acids)

>SMc02109 ATP-dependent Clp protease ATP-binding subunit protein (Sinorhizobium meliloti 1021)
MPTFSPSLEKALHQALTFANERHHEYATLEHLLLALIDDADAAAVMGACNVNLDTLRKTV
TDYVDNELSNLVTGYDEDSKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFAERESH
AAYFLQEQEMTRYDAVNFISHGIGKRPGSSEARPVRGAEDQDSEQKASRESEEAGPKKQQ
DALTAYCVNLNEKAKSGKIDPLIGRHAEVNRTIQVLCRRSKNNPLYVGDPGVGKTAIAEG
LAKRIIEKKVPEALQDATIFALDMGTLLAGTRYRGDFEERLKQVVKELEDYPGAVLFIDE
IHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYKEYRQFFEKDRALVRRFQKIDV
NEPTIADTIEIMKGLKPYFEDYHQLKYTNDAIKAAVELSARYINDRKLPDKAIDVIDESG
AAQMLLPVSKRRKLITEREIEATVATMARIPPKTVSKDDEAVLANLEQELRSVVYGQDLA
IEALASSIKLARAGLREPNKPIGCYVFSGPTGVGKTEVAKQLATSLGVELLRFDMSEYME
RHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLLLDEIEKAHPDLFNILLQVMDHGSL
TDHNGKKIDFRNVILIMTTNAGASDMARAAIGFGSSKRTGEDVEALNRLFTPEFRNRLDS
VIPFNSLPTPVIHKVVQKFVMQLETQLAERNVTFDLAPDAIAWLAERGYDEKMGARPLAR
VIQENIKKPLADEILFGKLKKGGVVKVTIGNKEDGTKGLMLEAVPETAPIKPKAEVSRPA
GKGAKPKKAAEKESVAAAEDGAKAKSKKTTAKSSNKSGGSSGAAPLRGRTVPKVPRKK