Protein Info for SMc02108 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 16 to 48 (33 residues), see Phobius details amino acids 51 to 92 (42 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 223 to 240 (18 residues), see Phobius details PF03591: AzlC" amino acids 31 to 163 (133 residues), 62.6 bits, see alignment E=2.8e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_1291)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92KD6 at UniProt or InterPro

Protein Sequence (248 amino acids)

>SMc02108 hypothetical protein (Sinorhizobium meliloti 1021)
MDSTNRIEEERSPLGWFLAGARGIFSLPAIILMLSFVGFCSLTVQAGIPPAQVVFMTGIV
WALPAKVILVSSILSGASLATAFLAVTLSSVRLMPMVAALVPELRTPKTPTWLLLVLSHF
IAITAWVFAMERVHAVPRQHRATFFAGFGITLVATNMALVGIVYRLVADFPPIVAGCLFF
LTPVYFLASIWNSARHPVVYAALAIGLVAGPLCYWIAPEFDILLAGLGGGTLAWAGERLW
RARREKSA