Protein Info for SMc02095 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 55 (17 residues), see Phobius details amino acids 113 to 137 (25 residues), see Phobius details amino acids 296 to 320 (25 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details PF02163: Peptidase_M50" amino acids 15 to 360 (346 residues), 234.2 bits, see alignment E=2.3e-73 TIGR00054: RIP metalloprotease RseP" amino acids 142 to 373 (232 residues), 177 bits, see alignment E=2.9e-56 PF00595: PDZ" amino acids 144 to 178 (35 residues), 24.7 bits, see alignment 5e-09 PF13180: PDZ_2" amino acids 144 to 202 (59 residues), 30.9 bits, see alignment E=5.6e-11 PF17820: PDZ_6" amino acids 147 to 198 (52 residues), 48.9 bits, see alignment 9.5e-17

Best Hits

Swiss-Prot: 100% identical to Y1501_RHIME: Putative zinc metalloprotease R01501 (R01501) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 100% identity to sme:SMc02095)

Predicted SEED Role

"Intramembrane protease RasP/YluC, implicated in cell division based on FtsL cleavage"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Q49 at UniProt or InterPro

Protein Sequence (374 amino acids)

>SMc02095 hypothetical protein (Sinorhizobium meliloti 1021)
MSLLLDNLQYTIPTFLFLLTLLVFVHEMGHYLVGRWSGIRILAFSVGFGPELFGWTDRHG
TRWKFCAVPLGGYVKFFGDEDAASTPDYRRLETIAPEERGRTFLGAKLWKRAATVAAGPI
ANFLLAIAIFAVLFSIYGRAVADPVVAFVAPDSAAEKAGVLPGDRLLSIDGKPIATFDDV
RRYVSVRPELPITVRIEREGAAIDLPMVPQRTESVDPLGNKMEEGKIGIGTNQEAGNFRV
ETYGPLEAVGQGALQSWRIVTGTLDYLSNLFVGRMSADQVGGPIRIAQMSGQMAKLGIAE
VLNFAAVLSVSIGLLNLMPVPVLDGGHLMFYAVEALRGRPVGPAAQDLAFRIGFAMVLML
TVFAAWNDINWLFG